Loading...
Statistics
Home - BECU Auto Event
www.becuautoeventwa.com/
Becuautoeventwa.com
Becuautoeventwa.com is hosted in
United States
/
San Antonio
.
Becuautoeventwa.com uses HTTPS protocol.
Number of used technologies:
10.
First technologies:
CSS, Google Font API, Html,
Number of used javascripts: 16.
First javascripts:
Jquery.js, Jquery-migrate.min.js, Frontend-builde...nctions.js,
Number of used analytics tools:
1.
First analytics tools:
Google Analytics,
Number of used plugins, modules: 2.
Its server type is:
nginx.
Its CMS is:
Wordpress.
Technologies in use by Becuautoeventwa.com
Technology
Number of occurences: 10
- CSS
- Google Font API
- Html
- Html5
- Javascript
- jQuery
- Php
- Pingback
- Shortcodes
- SVG
Advertisement
Javascripts
Number of occurences: 16
- jquery.js
- jquery-migrate.min.js
- frontend-builder-global-functions.js
- jquery.form.min.js
- scripts.js
- dealership_sort.js
- underscore.min.js
- backbone.min.js
- comment-reply.min.js
- jquery.mobile.custom.min.js
- custom.js
- jquery.fitvids.js
- waypoints.min.js
- jquery.magnific-popup.js
- frontend-builder-scripts.js
- wp-embed.min.js
Content Management System
Number of occurences: 1
- Wordpress
Analytics
Number of occurences: 1
- Google Analytics
Server Type
- nginx
Used plugins, modules
Number of plugins and modules: 2
- contact form 7
- products with categories
Google Analytics ID
- UA-76482433-1
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Not founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Not founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Becuautoeventwa.com
SSL certificate
- name: /CN=*.wpengine.com
- subject:
- CN: *.wpengine.com
- hash: 7be72f8f
- issuer:
- C: US
- O: GeoTrust Inc.
- CN: RapidSSL SHA256 CA - G3
- version: 2
- serialNumber: 583484
- validFrom: 151210045023Z
- validTo: 180520152913Z
- validFrom_time_t: 1449723023
- validTo_time_t: 1526830153
- extensions:
- authorityKeyIdentifier: keyid:C3:9C:F3:FC:D3:46:08:34:BB:CE:46:7F:A0:7C:5B:F3:E2:08:CB:59
- authorityInfoAccess: OCSP - URI:http://gv.symcd.com CA Issuers - URI:http://gv.symcb.com/gv.crt
- keyUsage: Digital Signature, Key Encipherment
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- subjectAltName: DNS:*.wpengine.com, DNS:wpengine.com
- crlDistributionPoints: Full Name: URI:http://gv.symcb.com/gv.crl
- basicConstraints: CA:FALSE
- certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.rapidssl.com/legal
Number of occurences: 6
- Name:
Content: BECU Auto Event - Name: robots
Content: noindex,follow - Name: twitter:card
Content: summary - Name: twitter:title
Content: Home - BECU Auto Event - Name: generator
Content: Divi Child v.1.0.0 - Name: viewport
Content: width=device-width, initial-scale=1.0, maximum-scale=1.0, user-scalable=0
Server / Hosting
- IP: 104.130.209.79
- Latitude: 29.49
- Longitude: -98.40
- Country: United States
- City: San Antonio
Rname
- ns45.domaincontrol.com
- ns46.domaincontrol.com
- mailstore1.secureserver.net
- smtp.secureserver.net
Target
- dns.jomax.net
HTTP Header Response
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Sun, 25 Sep 2016 03:05:30 GMT
Content-Type: text/html
Content-Length: 178
Location: http://www.becuautoeventnw.com/
X-Cache: MISS from s_wx1113
Via: 1.1 s_wx1113 (squid/3.5.20)
Connection: keep-alive
HTTP/1.1 200 OK
Server: nginx
Date: Sun, 25 Sep 2016 03:05:30 GMT
Content-Type: text/html; charset=UTF-8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Pragma: no-cache
X-Pingback: http://www.becuautoeventnw.com/xmlrpc.php
Link: ; rel="https://api.w.org/"
Link: ; rel=shortlink
X-Cacheable: SHORT
Vary: Accept-Encoding,Cookie
Cache-Control: max-age=600, must-revalidate
X-Cache: HIT: 1
X-Pass-Why:
X-Cache-Group: normal
X-Type: default
X-Cache: MISS from s_wx1113
Transfer-Encoding: chunked
Via: 1.1 s_wx1113 (squid/3.5.20)
Connection: keep-alive
DNS
host: becuautoeventwa.com
- class: IN
- ttl: 600
- type: A
- ip: 104.130.209.79
host: becuautoeventwa.com
- class: IN
- ttl: 3600
- type: NS
- target: ns45.domaincontrol.com
host: becuautoeventwa.com
- class: IN
- ttl: 3600
- type: NS
- target: ns46.domaincontrol.com
host: becuautoeventwa.com
- class: IN
- ttl: 3600
- type: SOA
- mname: ns45.domaincontrol.com
- rname: dns.jomax.net
- serial: 2016050300
- refresh: 28800
- retry: 7200
- expire: 604800
- minimum-ttl: 600
host: becuautoeventwa.com
- class: IN
- ttl: 3600
- type: MX
- pri: 10
- target: mailstore1.secureserver.net
host: becuautoeventwa.com
- class: IN
- ttl: 3600
- type: MX
- pri: 0
- target: smtp.secureserver.net
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.ecuautoeventwa.com, www.bqecuautoeventwa.com, www.qecuautoeventwa.com, www.bwecuautoeventwa.com, www.wecuautoeventwa.com, www.bzecuautoeventwa.com, www.zecuautoeventwa.com, www.bxecuautoeventwa.com, www.xecuautoeventwa.com, www.becuautoeventwa.com, www.ecuautoeventwa.com, www.bsecuautoeventwa.com, www.secuautoeventwa.com, www.byecuautoeventwa.com, www.yecuautoeventwa.com, www.beecuautoeventwa.com, www.eecuautoeventwa.com, www.bdecuautoeventwa.com, www.decuautoeventwa.com, www.bcecuautoeventwa.com, www.cecuautoeventwa.com, www.bcuautoeventwa.com, www.bexcuautoeventwa.com, www.bxcuautoeventwa.com, www.bescuautoeventwa.com, www.bscuautoeventwa.com, www.bewcuautoeventwa.com, www.bwcuautoeventwa.com, www.bercuautoeventwa.com, www.brcuautoeventwa.com, www.befcuautoeventwa.com, www.bfcuautoeventwa.com, www.bevcuautoeventwa.com, www.bvcuautoeventwa.com, www.beccuautoeventwa.com, www.bccuautoeventwa.com, www.beqcuautoeventwa.com, www.bqcuautoeventwa.com, www.beacuautoeventwa.com, www.bacuautoeventwa.com, www.beycuautoeventwa.com, www.bycuautoeventwa.com, www.beuautoeventwa.com, www.becduautoeventwa.com, www.beduautoeventwa.com, www.becruautoeventwa.com, www.beruautoeventwa.com, www.bectuautoeventwa.com, www.betuautoeventwa.com, www.becvuautoeventwa.com, www.bevuautoeventwa.com, www.becfuautoeventwa.com, www.befuautoeventwa.com, www.becguautoeventwa.com, www.beguautoeventwa.com, www.bechuautoeventwa.com, www.behuautoeventwa.com, www.becnuautoeventwa.com, www.benuautoeventwa.com, www.becmuautoeventwa.com, www.bemuautoeventwa.com, www.becjuautoeventwa.com, www.bejuautoeventwa.com, www.becautoeventwa.com, www.becuwautoeventwa.com, www.becwautoeventwa.com, www.becueautoeventwa.com, www.beceautoeventwa.com, www.becusautoeventwa.com, www.becsautoeventwa.com, www.becuaautoeventwa.com, www.becaautoeventwa.com, www.becuutoeventwa.com, www.becuaoutoeventwa.com, www.becuoutoeventwa.com, www.becuaputoeventwa.com, www.becuputoeventwa.com, www.becua9utoeventwa.com, www.becu9utoeventwa.com, www.becuautoeventwa.com, www.becuutoeventwa.com, www.becuaiutoeventwa.com, www.becuiutoeventwa.com, www.becuauutoeventwa.com, www.becuuutoeventwa.com, www.becuatoeventwa.com, www.becuauwtoeventwa.com, www.becuawtoeventwa.com, www.becuauetoeventwa.com, www.becuaetoeventwa.com, www.becuaustoeventwa.com, www.becuastoeventwa.com, www.becuauatoeventwa.com, www.becuaatoeventwa.com, www.becuauoeventwa.com, www.becuautqoeventwa.com, www.becuauqoeventwa.com, www.becuautaoeventwa.com, www.becuauaoeventwa.com, www.becuaut oeventwa.com, www.becuau oeventwa.com, www.becuautwoeventwa.com, www.becuauwoeventwa.com, www.becuauteoeventwa.com, www.becuaueoeventwa.com, www.becuautzoeventwa.com, www.becuauzoeventwa.com, www.becuautxoeventwa.com, www.becuauxoeventwa.com, www.becuautcoeventwa.com, www.becuaucoeventwa.com, www.becuauteventwa.com, www.becuautobeventwa.com, www.becuautbeventwa.com, www.becuautoheventwa.com, www.becuautheventwa.com, www.becuautogeventwa.com, www.becuautgeventwa.com, www.becuautojeventwa.com, www.becuautjeventwa.com, www.becuautomeventwa.com, www.becuautmeventwa.com, www.becuauto eventwa.com, www.becuaut eventwa.com, www.becuautoveventwa.com, www.becuautveventwa.com, www.becuautoventwa.com, www.becuautoexventwa.com, www.becuautoxventwa.com, www.becuautoesventwa.com, www.becuautosventwa.com, www.becuautoewventwa.com, www.becuautowventwa.com, www.becuautoerventwa.com, www.becuautorventwa.com, www.becuautoefventwa.com, www.becuautofventwa.com, www.becuautoevventwa.com, www.becuautovventwa.com, www.becuautoecventwa.com, www.becuautocventwa.com, www.becuautoeqventwa.com, www.becuautoqventwa.com, www.becuautoeaventwa.com, www.becuautoaventwa.com, www.becuautoeyventwa.com, www.becuautoyventwa.com, www.becuautoeentwa.com, www.becuautoevyentwa.com, www.becuautoeyentwa.com, www.becuautoevzentwa.com, www.becuautoezentwa.com, www.becuautoevhentwa.com, www.becuautoehentwa.com, www.becuautoevnentwa.com, www.becuautoenentwa.com, www.becuautoevmentwa.com, www.becuautoementwa.com, www.becuautoevjentwa.com, www.becuautoejentwa.com, www.becuautoevkentwa.com, www.becuautoekentwa.com, www.becuautoevientwa.com, www.becuautoeientwa.com,
Other websites we recently analyzed
- secret-money
Ashburn (United States) - 52.203.203.182
Server software: Pepyaka/1.9.13
Technology: CSS, Html, Html5, Javascript, Wix
Number of Javascript: 2
Number of meta tags: 5 - Baustelle
Germany - 134.0.26.187
Server software: Apache/2.4.20 (Unix) OpenSSL/1.0.1e mod_fcgid/2.3.9
Technology: Html - Perspolis Medical Center
Germany - 78.47.80.79
Server software: nginx
Technology: CSS, Google Font API, Html, Html5, Php
Number of Javascript: 8
Number of meta tags: 2 - opends.us
Road Town (Virgin Islands, British) - 208.91.197.160
Server software: Apache
Technology: Html
Number of meta tags: 2 - servico.info - Diese Website steht zum Verkauf! - Informationen zum Thema servico.
Diese Website steht zum Verkauf! servico.info ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf servico.info alles. Wir hoffen, dass Sie hier das Gesuchte finden!Cambridge (United States) - 72.52.4.90
Server software: Apache
Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
Number of Javascript: 3
Number of meta tags: 4 - Roma Hotel
RomaHotel.it - Guida turistica e Hotel di Roma. Oltre 1100 Hotel a Roma che puoi prenotare online. Servizio di assistenza e prenotazione Hotel a Roma: inoltre Mappa della Città di Roma, Cosa Vedere, Itinerari, Musei e Attrazioni Turistiche di RomaArezzo (Italy) - 46.37.17.210
Server software: Apache/2.2.15 (CentOS)
Technology: Google Adsense, AJAX Libraries API, CSS, Html, Javascript, Php, Google +1 Button
Number of Javascript: 6
Number of meta tags: 4 - 35789.kim
China - 124.16.31.156
Server software: Tengine/1.4.2
Technology: CloudFront, Google Adsense, Html, Javascript, Php
Number of Javascript: 2
Number of meta tags: 1 - calvarychapelmerrimackvalley.com at Directnic
Cayman Islands - 74.117.222.18
Server software: nginx/1.5.0
Technology: Html, Javascript
Number of Javascript: 1 - Massachusetts Society of Mayflower Descendants - HOME
The Mission of the Massachusetts Society of Mayflower Descendants is to gather together to honor and perpetuate the memory of our Mayflower Ancestors and the ideals of American freedoms and democracy, which have evolved from The Mayflower Compact signed by the Pilgrim Fathers when they reached Cape Cod shores in November, 1620.Provo (United States) - 67.20.65.25
Server software: nginx/1.10.1
Technology: PayPal, CSS, Html, Javascript, Php, Joomla, Add This
Number of Javascript: 15
Number of meta tags: 5 - 55517.date - Diese Website steht zum Verkauf! - Informationen zum Thema 55517.
Diese Website steht zum Verkauf! 55517.date ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf 55517.date alles. Wir hoffen, dass Sie hier das Gesuchte finden!Cambridge (United States) - 72.52.4.90
Server software: Apache/2.2.22 (Debian)
Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
Number of Javascript: 4
Number of meta tags: 5